Crystal structure of human tdp-43 rrm1 domain in complex with a single-stranded dna
PDB DOI: 10.2210/pdb4iuf/pdb
Classification: TRANSCRIPTION REGULATOR/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2013-01-21 Deposition Author(s): Doudeva, L.G. , Kuo, P.H. , Wang, Y.T. , Yang, W.Z. , Yuan, H.S.
Method: X-RAY DIFFRACTION Resolution: 2.752 Å
Crystal structure of human tdp-43 rrm1 domain in complex with a single-stranded dna
Doudeva, L.G. , Kuo, P.H. , Wang, Y.T. , Yang, W.Z. , Yuan, H.S.
Primary Citation of Related Structures: 4IUF
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
TAR DNA-binding protein 43 | A | 77 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPN |
Nucleic Acids / Hybrid | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
5'-D(*GP*TP*TP*GP*(XUA)P*GP*CP*GP*T)-3' | b | 9 | NA | GTTGAGCGT |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-01-21 Deposition Author(s): Doudeva, L.G. , Kuo, P.H. , Wang, Y.T. , Yang, W.Z. , Yuan, H.S.