4IIO
Crystal structure of the second sh3 domain of itsn2 bound with a synthetic peptide
PDB DOI: 10.2210/pdb4iio/pdb
Classification: ENDOCYTOSIS Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-12-20 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Gu, J. , Guan, X. , Huang, H. , Sidhu, S. , Structural Genomics Consortium (Sgc) , Tempel, W. , Tong, Y.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Crystal structure of the second sh3 domain of itsn2 bound with a synthetic peptide
Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Gu, J. , Guan, X. , Huang, H. , Sidhu, S. , Structural Genomics Consortium (Sgc) , Tempel, W. , Tong, Y.
Primary Citation of Related Structures: 4IIO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Intersectin-2 | A | 66 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GGMAQGALLKAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPAAA |
| Intersectin-2 | B | 66 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GGMAQGALLKAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPAAA |
| Synthetic Peptide | C | 13 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XWRGSLSYLKGPL |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2012-12-20 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Gu, J. , Guan, X. , Huang, H. , Sidhu, S. , Structural Genomics Consortium (Sgc) , Tempel, W. , Tong, Y.