4IFF
Structural organization of ftsb, a transmembrane protein of the bacterial divisome
PDB DOI: 10.2210/pdb4iff/pdb
Classification: CELL CYCLE Organism(s): Bacillus Phage Phi29 , Escherichia Coli
Deposited: 2012-12-14 Deposition Author(s): Khadria, A. , Lapointe, L.M. , Rayment, I. , Senes, A. , Subramaniam, S. , Taylor, K.C.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.3 Å
Structural organization of ftsb, a transmembrane protein of the bacterial divisome
Khadria, A. , Lapointe, L.M. , Rayment, I. , Senes, A. , Subramaniam, S. , Taylor, K.C.
Primary Citation of Related Structures: 4IFF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Fusion of phage phi29 Gp7 protein and Cell division protein FtsB | A | 86 | Bacillus Phage Phi29 , Escherichia Coli | GSGPLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGG |
| Fusion of phage phi29 Gp7 protein and Cell division protein FtsB | B | 86 | Bacillus Phage Phi29 , Escherichia Coli | GSGPLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGG |
| Fusion of phage phi29 Gp7 protein and Cell division protein FtsB | C | 86 | Bacillus Phage Phi29 , Escherichia Coli | GSGPLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGG |
| Fusion of phage phi29 Gp7 protein and Cell division protein FtsB | D | 86 | Bacillus Phage Phi29 , Escherichia Coli | GSGPLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGG |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2012-12-14 Deposition Author(s): Khadria, A. , Lapointe, L.M. , Rayment, I. , Senes, A. , Subramaniam, S. , Taylor, K.C.