4HVW
Crystal structure of the t98e c-src-sh3 domain mutant in complex with the high affinity peptide vsl12
PDB DOI: 10.2210/pdb4hvw/pdb
Classification: Signaling Protein/Peptide Organism(s): Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-11-07 Deposition Author(s): Camara-Artigas, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 0.98 Å
Crystal structure of the t98e c-src-sh3 domain mutant in complex with the high affinity peptide vsl12
Primary Citation of Related Structures: 4HVW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proto-oncogene tyrosine-protein kinase Src | A | 61 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMTFVALYDYESRTEEDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD |
| SYNTHETIC PEPTIDE Acetyl-VSLARRPLPPLP | B | 13 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XVSLARRPLPPLP |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2012-11-07 Deposition Author(s): Camara-Artigas, A.