Mechanism of creb recognition and coactivation by the creb regulated transcriptional coactivator crtc2
PDB DOI: 10.2210/pdb4htm/pdb
Classification: PROTEIN BINDING Organism(s): N.A.
Deposited: 2012-11-01 Deposition Author(s): Kumar, G.S. , Luo, Q. , Mayo, K. , Montminy, M. , Radhakrishnan, I. , Talai, A. , Tsai, W.-W. , Urday-Zaa, J.C. , Viste, K.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Mechanism of creb recognition and coactivation by the creb regulated transcriptional coactivator crtc2
Kumar, G.S. , Luo, Q. , Mayo, K. , Montminy, M. , Radhakrishnan, I. , Talai, A. , Tsai, W.-W. , Urday-Zaa, J.C. , Viste, K.
Primary Citation of Related Structures: 4HTM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CREB-regulated transcription coactivator 2 | A | 34 | N.A. | YNPRKFSEKIALQKQRQAEETAAFEEVMMDIGST |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-11-01 Deposition Author(s): Kumar, G.S. , Luo, Q. , Mayo, K. , Montminy, M. , Radhakrishnan, I. , Talai, A. , Tsai, W.-W. , Urday-Zaa, J.C. , Viste, K.