1.88 angstrom x-ray crystal structure of piconlinic-bound 3-hydroxyanthranilate-3,4-dioxygenase
PDB DOI: 10.2210/pdb4hsj/pdb
Classification: Oxidoreductase/Oxidoreductase inhibitor Organism(s): Cupriavidus Metallidurans
Deposited: 2012-10-30 Deposition Author(s): Chen, L. , Davis, C.I. , Liu, A. , Liu, F.
1.88 angstrom x-ray crystal structure of piconlinic-bound 3-hydroxyanthranilate-3,4-dioxygenase
Chen, L. , Davis, C.I. , Liu, A. , Liu, F.
Primary Citation of Related Structures: 4HSJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 3-hydroxyanthranilate 3,4-dioxygenase | A | 174 | Cupriavidus Metallidurans | MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-10-30 Deposition Author(s): Chen, L. , Davis, C.I. , Liu, A. , Liu, F.