Identification of function and mechanistic insights of guanine deaminase from nitrosomonas europaea
PDB DOI: 10.2210/pdb4hrw/pdb
Classification: HYDROLASE Organism(s): Nitrosomonas Europaea
Deposited: 2012-10-29 Deposition Author(s): Anand, R. , Bhukya, H. , Bitra, A. , Tanwar, A.S.
Identification of function and mechanistic insights of guanine deaminase from nitrosomonas europaea
Anand, R. , Bhukya, H. , Bitra, A. , Tanwar, A.S.
Primary Citation of Related Structures: 4HRW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cytidine and deoxycytidylate deaminase zinc-binding region | A | 197 | Nitrosomonas Europaea | GHMNDALHIGLPPFLVQANNEPRVLAAPEARMGYVLELVRANIAADGGPFAAAVFERDSGLLIAAGTNRVVPGRCSAAHAAILALSLAQAKLDTHDLSADGLPACELVTSAEPCVMCFGAVIWSGVRSLVCAARSDDVEAIGFDEGPRPENWMGGLEARGITVTTGLLRDAACALLREYNACNGVIYNARCGVHKGS |
| Cytidine and deoxycytidylate deaminase zinc-binding region | B | 197 | Nitrosomonas Europaea | GHMNDALHIGLPPFLVQANNEPRVLAAPEARMGYVLELVRANIAADGGPFAAAVFERDSGLLIAAGTNRVVPGRCSAAHAAILALSLAQAKLDTHDLSADGLPACELVTSAEPCVMCFGAVIWSGVRSLVCAARSDDVEAIGFDEGPRPENWMGGLEARGITVTTGLLRDAACALLREYNACNGVIYNARCGVHKGS |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-10-29 Deposition Author(s): Anand, R. , Bhukya, H. , Bitra, A. , Tanwar, A.S.