Crystal structure of tet3 in complex with a cpg dsdna
PDB DOI: 10.2210/pdb4hp3/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Canine Parvovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-10-23 Deposition Author(s): Arrowsmith, C.H. , Bian, C. , Bountra, C. , Chao, X. , Edwards, A.M. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.
Crystal structure of tet3 in complex with a cpg dsdna
Arrowsmith, C.H. , Bian, C. , Bountra, C. , Chao, X. , Edwards, A.M. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.
Primary Citation of Related Structures: 4HP3
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
LOC100036628 protein | C | 72 | Canine Parvovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MHHHHHHSSGRENLYFQGSNKKRKRCGVCVPCLRKEPCGACYNCVNRSTSHQICKMRKCEQLKKKRVVPMKG |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-10-23 Deposition Author(s): Arrowsmith, C.H. , Bian, C. , Bountra, C. , Chao, X. , Edwards, A.M. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.