Crystal structure of tet3 in complex with a non-cpg dsdna
PDB DOI: 10.2210/pdb4hp1/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Xenopus (Silurana) Tropicalis , Synthetic Construct
Deposited: 2012-10-23 Deposition Author(s): Arrowsmith, C.H. , Bian, C. , Bountra, C. , Chao, X. , Edwards, A.M. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.
Method: X-RAY DIFFRACTION Resolution: 2.25 Å
Crystal structure of tet3 in complex with a non-cpg dsdna
Arrowsmith, C.H. , Bian, C. , Bountra, C. , Chao, X. , Edwards, A.M. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.
Primary Citation of Related Structures: 4HP1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| LOC100036628 protein | C | 72 | Xenopus (Silurana) Tropicalis , Synthetic Construct | MHHHHHHSSGRENLYFQGSNKKRKRCGVCVPCLRKEPCGACYNCVNRSTSHQICKMRKCEQLKKKRVVPMKG |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-10-23 Deposition Author(s): Arrowsmith, C.H. , Bian, C. , Bountra, C. , Chao, X. , Edwards, A.M. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.