High resolution structure of chemotaxis response regulator chey4 of vibrio cholerae
PDB DOI: 10.2210/pdb4hnr/pdb
Classification: SIGNALING PROTEIN Organism(s): Vibrio Cholerae
Deposited: 2012-10-21 Deposition Author(s): Biswas, M. , Dasgupta, J. , Sen, U.
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
High resolution structure of chemotaxis response regulator chey4 of vibrio cholerae
Biswas, M. , Dasgupta, J. , Sen, U.
Primary Citation of Related Structures: 4HNR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chemotaxis protein CheY | A | 120 | Vibrio Cholerae | TMAKVLAVDDSISIRQMVSHTLQDAGYEVETAADGREALAKAQKARFDVIISDVNMPVMTGFEFVKAVRMQSQYKFTPILMLTTETSPEKKQEGKAVGATGWLVKPFNPETLLKTLQRVL |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-10-21 Deposition Author(s): Biswas, M. , Dasgupta, J. , Sen, U.