Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggtttcggt)
PDB DOI: 10.2210/pdb4hj5/pdb
Classification: DNA BINDING PROTEIN Organism(s): Conus Stercusmuscarum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-10-12 Deposition Author(s): Dickey, T.H. , Wuttke, D.S.
Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggtttcggt)
Primary Citation of Related Structures: 4HJ5
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protection of telomeres protein 1 | A | 143 | Conus Stercusmuscarum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSDSFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYVQN |
Nucleic Acids / Hybrid | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
DNA (5'-D(*GP*GP*TP*TP*TP*CP*GP*GP*T)-3') | b | 9 | NA | GGTTTCGGT |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-10-12 Deposition Author(s): Dickey, T.H. , Wuttke, D.S.