Intermolecular recognition revealed by the complex structure of human clock-bmal1 basic helix-loop-helix domains with e-box dna
PDB DOI: 10.2210/pdb4h10/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2012-09-10 Deposition Author(s): Su, X.-D. , Wang, Z.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Aryl hydrocarbon receptor nuclear translocator-like protein 1 | A | 73 | Homo Sapiens , Synthetic Construct | MHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGAWLEHHHHHH |
Circadian locomoter output cycles protein kaput | B | 71 | Homo Sapiens , Synthetic Construct | MDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAWLEHHHHHH |
Method: X-RAY DIFFRACTION