Crystal structure of mutant orr3 in complex with ntd of arar
PDB DOI: 10.2210/pdb4h0e/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Bacillus Subtilis , Synthetic Construct
Deposited: 2012-09-08 Deposition Author(s): Jain, D. , Nair, D.T.
Crystal structure of mutant orr3 in complex with ntd of arar
Primary Citation of Related Structures: 4H0E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Arabinose metabolism transcriptional repressor | A | 88 | Bacillus Subtilis , Synthetic Construct | MHHHHHHLEVLFQGPLGSEFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLYSVQGGGTFVA |
| Arabinose metabolism transcriptional repressor | B | 88 | Bacillus Subtilis , Synthetic Construct | MHHHHHHLEVLFQGPLGSEFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLYSVQGGGTFVA |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-09-08 Deposition Author(s): Jain, D. , Nair, D.T.