Structure of racemic pin1 ww domain cocrystallized with dl-malic acid
PDB DOI: 10.2210/pdb4gwt/pdb
Classification: PROTEIN BINDING Organism(s): N.A.
Deposited: 2012-09-03 Deposition Author(s): Forest, K.T. , Gellman, S.H. , Mortenson, D.E. , Yun, H.G.
Method: X-RAY DIFFRACTION Resolution: 2.25 Å
Structure of racemic pin1 ww domain cocrystallized with dl-malic acid
Forest, K.T. , Gellman, S.H. , Mortenson, D.E. , Yun, H.G.
Primary Citation of Related Structures: 4GWT
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 | A | 36 | N.A. | GSKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSG |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-09-03 Deposition Author(s): Forest, K.T. , Gellman, S.H. , Mortenson, D.E. , Yun, H.G.