Crystal structure of t-cell lymphoma invasion and metastasis-1 pdz in complex with phosphorylated syndecan1 peptide
PDB DOI: 10.2210/pdb4gvc/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2012-08-30 Deposition Author(s): Fuentes, E.J. , Liu, X. , Murray, A.M. , Shepherd, T.R. , Xu, Z.
Method: X-RAY DIFFRACTION Resolution: 1.54 Å
Crystal structure of t-cell lymphoma invasion and metastasis-1 pdz in complex with phosphorylated syndecan1 peptide
Fuentes, E.J. , Liu, X. , Murray, A.M. , Shepherd, T.R. , Xu, Z.
Primary Citation of Related Structures: 4GVC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| T-lymphoma invasion and metastasis-inducing protein 1 | A | 94 | Homo Sapiens , Synthetic Construct | GAMGKVTHSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPEL |
| Syndecan-1 | B | 8 | Homo Sapiens , Synthetic Construct | TKQEEFYA |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-08-30 Deposition Author(s): Fuentes, E.J. , Liu, X. , Murray, A.M. , Shepherd, T.R. , Xu, Z.