C-terminal coiled-coil domain of transient receptor potential channel trpp3 (pkd2l1, polycystin-l)
PDB DOI: 10.2210/pdb4gif/pdb
Classification: TRANSPORT PROTEIN Organism(s): Homo Sapiens
Deposited: 2012-08-08 Deposition Author(s): Dobbins, S. , Isacoff, E.Y. , Li, M.-H. , Tong, L. , Ulbrich, M.H. , Yang, J. , Yu, Y. , Zhang, W.K.
C-terminal coiled-coil domain of transient receptor potential channel trpp3 (pkd2l1, polycystin-l)
Dobbins, S. , Isacoff, E.Y. , Li, M.-H. , Tong, L. , Ulbrich, M.H. , Yang, J. , Yu, Y. , Zhang, W.K.
Primary Citation of Related Structures: 4GIF
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Polycystic kidney disease 2-like 1 protein | A | 45 | Homo Sapiens | GGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKMLERKGW |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-08-08 Deposition Author(s): Dobbins, S. , Isacoff, E.Y. , Li, M.-H. , Tong, L. , Ulbrich, M.H. , Yang, J. , Yu, Y. , Zhang, W.K.