Crystal structure of human atg12~atg5 conjugate in complex with an n-terminal fragment of atg16l1
PDB DOI: 10.2210/pdb4gdl/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2012-07-31 Deposition Author(s): Metlagel, Z. , Otomo, C. , Otomo, T. , Takaesu, G.
Crystal structure of human atg12~atg5 conjugate in complex with an n-terminal fragment of atg16l1
Metlagel, Z. , Otomo, C. , Otomo, T. , Takaesu, G.
Primary Citation of Related Structures: 4GDL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ubiquitin-like protein ATG12 | A | 91 | Homo Sapiens | GSKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG |
| Autophagy protein 5 | B | 275 | Homo Sapiens | MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVMRQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD |
| Autophagy-related protein 16-1 | C | 36 | Homo Sapiens | SHMPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLL |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-07-31 Deposition Author(s): Metlagel, Z. , Otomo, C. , Otomo, T. , Takaesu, G.