Solution nmr structure of the wild type dna binding domain of area complexed to a 13bp dna containing a cgata site, regularized mean structure
PDB DOI: 10.2210/pdb4gat/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Sphingomonas Sp. Y57 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 1997-11-07 Deposition Author(s): Clore, G.M. , Gronenborn, A.M. , Starich, M. , Wikstrom, M.
Solution nmr structure of the wild type dna binding domain of area complexed to a 13bp dna containing a cgata site, regularized mean structure
Clore, G.M. , Gronenborn, A.M. , Starich, M. , Wikstrom, M.
Primary Citation of Related Structures: 4GAT
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
NITROGEN REGULATORY PROTEIN AREA | A | 66 | Sphingomonas Sp. Y57 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MKNGEQNGPTTCTNCFTQTTPLWRRNPEGQPLCNACGLFLKLHGVVRPLSLKTDVIKKRNRNSANS |
Method: SOLUTION NMR
Deposited Date: 1997-11-07 Deposition Author(s): Clore, G.M. , Gronenborn, A.M. , Starich, M. , Wikstrom, M.