Advanced Search:
4G9B
Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
PDB DOI: 10.2210/pdb4g9b/pdb
Classification: ISOMERASE Organism(s): Escherichia Coli
Deposited: 2012-07-23 Deposition Author(s): Al Obaidi, N.F. , Allen, K.N. , Almo, S.C. , Bhosle, R. , Chowdhury, S. , Dunaway-Mariano, D. , Enzyme Function Initiative (Efi) , Evans, B. , Gerlt, J.A. , Hammonds, J. , Hillerich, B. , Imker, H.J. , Love, J. , Morisco, L.L. , Scott Glenn, A. , Seidel, R.D. , Sojitra, S. , Toro, R. , Vetting, M.W. , Washington, E. , Wasserman, S.R.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
Al Obaidi, N.F. , Allen, K.N. , Almo, S.C. , Bhosle, R. , Chowdhury, S. , Dunaway-Mariano, D. , Enzyme Function Initiative (Efi) , Evans, B. , Gerlt, J.A. , Hammonds, J. , Hillerich, B. , Imker, H.J. , Love, J. , Morisco, L.L. , Scott Glenn, A. , Seidel, R.D. , Sojitra, S. , Toro, R. , Vetting, M.W. , Washington, E. , Wasserman, S.R.
Primary Citation of Related Structures: 4G9B
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Beta-phosphoglucomutase | A | 243 | Escherichia Coli | MVMKLQGVIFDLDGVITDTAHLHFQAWQQIAAEIGISIDAQFNESLKGISRDESLRRILQHGGKEGDFNSQERAQLAYRKNLLYVHSLRELTVNAVLPGIRSLLADLRAQQISVGLASVSLNAPTILAALELREFFTFCADASQLKNSKPDPEIFLAACAGLGVPPQACIGIEDAQAGIDAINASGMRSVGIGAGLTGAQLLLPSTESLTWPRLSAFWQNVAENLYFQSHHHHHHWSHPQFEK |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2012-07-23 Deposition Author(s): Al Obaidi, N.F. , Allen, K.N. , Almo, S.C. , Bhosle, R. , Chowdhury, S. , Dunaway-Mariano, D. , Enzyme Function Initiative (Efi) , Evans, B. , Gerlt, J.A. , Hammonds, J. , Hillerich, B. , Imker, H.J. , Love, J. , Morisco, L.L. , Scott Glenn, A. , Seidel, R.D. , Sojitra, S. , Toro, R. , Vetting, M.W. , Washington, E. , Wasserman, S.R.