Crystal structure of s-adenosylhomocysteine nucleosidase from streptococcus pyogenes in complex with 5-methylthiotubericidin
PDB DOI: 10.2210/pdb4g41/pdb
Classification: HYDROLASE Organism(s): Streptococcus Pyogenes
Deposited: 2012-07-15 Deposition Author(s): Anderson, B.F. , Brown, R.L. , Evans, G.B. , Frohlich, R. , Norris, G.E. , Ponniah, K. , Tyler, P.C.
Crystal structure of s-adenosylhomocysteine nucleosidase from streptococcus pyogenes in complex with 5-methylthiotubericidin
Anderson, B.F. , Brown, R.L. , Evans, G.B. , Frohlich, R. , Norris, G.E. , Ponniah, K. , Tyler, P.C.
Primary Citation of Related Structures: 4G41
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| MTA/SAH nucleosidase | A | 236 | Streptococcus Pyogenes | GAMGSMKIGIIAAMEEELSLLLANLLDAQEHQVLSKTYYTGRFGKHELILVQSGVGKVMSAMTVAILVEHFKAQAIINTGSAGAVASHLAIGDVVVADRLVYHDVDATAFGYAYGQMAGQPLYYDCDPQFVAIFKQVLKHEKTNGQVGLIATGDSFVAGQDKIDQIKTAFSNVLAVEMEGAAIAQAAHTAGKPFIVVRAMSDTAAHDANITFDQFIIEAGKRSAQILMTFLENLPV |
| MTA/SAH nucleosidase | B | 236 | Streptococcus Pyogenes | GAMGSMKIGIIAAMEEELSLLLANLLDAQEHQVLSKTYYTGRFGKHELILVQSGVGKVMSAMTVAILVEHFKAQAIINTGSAGAVASHLAIGDVVVADRLVYHDVDATAFGYAYGQMAGQPLYYDCDPQFVAIFKQVLKHEKTNGQVGLIATGDSFVAGQDKIDQIKTAFSNVLAVEMEGAAIAQAAHTAGKPFIVVRAMSDTAAHDANITFDQFIIEAGKRSAQILMTFLENLPV |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-07-15 Deposition Author(s): Anderson, B.F. , Brown, R.L. , Evans, G.B. , Frohlich, R. , Norris, G.E. , Ponniah, K. , Tyler, P.C.