4G35
Mcl-1 in complex with a biphenyl cross-linked noxa peptide.
PDB DOI: 10.2210/pdb4g35/pdb
Classification: Apoptosis/Inhibitor Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-07-13 Deposition Author(s): Drake, E. , Edwardraja, S. , Gulick, A.M. , Lin, Q.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2 Å
Mcl-1 in complex with a biphenyl cross-linked noxa peptide.
Drake, E. , Edwardraja, S. , Gulick, A.M. , Lin, Q.
Primary Citation of Related Structures: 4G35
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Induced myeloid leukemia cell differentiation protein Mcl-1 homolog | A | 165 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSPEFEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGG |
| Noxa BH3 peptide (cysteine-mediated cross-linked) | B | 21 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XAACLRRIGDCVNLRQKLLNX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2012-07-13 Deposition Author(s): Drake, E. , Edwardraja, S. , Gulick, A.M. , Lin, Q.