Crystal structure of the isolated e. coli rele toxin, p212121 form
PDB DOI: 10.2210/pdb4fxh/pdb
Classification: TOXIN Organism(s): Escherichia Coli
Deposited: 2012-07-03 Deposition Author(s): Boggild, A. , Brodersen, D.E. , Sofos, N.
Crystal structure of the isolated e. coli rele toxin, p212121 form
Boggild, A. , Brodersen, D.E. , Sofos, N.
Primary Citation of Related Structures: 4FXH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| mRNA interferase RelE | A | 95 | Escherichia Coli | MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKAERSEVYSEAVKRIL |
| mRNA interferase RelE | B | 95 | Escherichia Coli | MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKAERSEVYSEAVKRIL |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-07-03 Deposition Author(s): Boggild, A. , Brodersen, D.E. , Sofos, N.