Crystal structure of isdi-w66y in complex with heme
PDB DOI: 10.2210/pdb4fnh/pdb
Classification: OXIDOREDUCTASE Organism(s): Staphylococcus Aureus Subsp. Aureus
Deposited: 2012-06-19 Deposition Author(s): Murphy, M.E.P. , Ukpabi, G.N.
Crystal structure of isdi-w66y in complex with heme
Primary Citation of Related Structures: 4FNH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Heme-degrading monooxygenase isdI | A | 110 | Staphylococcus Aureus Subsp. Aureus | AHMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNYLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK |
| Heme-degrading monooxygenase isdI | B | 110 | Staphylococcus Aureus Subsp. Aureus | AHMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNYLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-06-19 Deposition Author(s): Murphy, M.E.P. , Ukpabi, G.N.