High resolution structure of the manganese derivative of insulin
PDB DOI: 10.2210/pdb4fka/pdb
Classification: HORMONE Organism(s): Salmonella Enterica
Deposited: 2012-06-13 Deposition Author(s): Matkovic-Calogovic, D. , Prugovecki, B. , Pulic, I. , Toth, M.
High resolution structure of the manganese derivative of insulin
Matkovic-Calogovic, D. , Prugovecki, B. , Pulic, I. , Toth, M.
Primary Citation of Related Structures: 4FKA
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin A chain | A | 21 | Salmonella Enterica | GIVEQCCTSICSLYQLENYCN |
Insulin A chain | C | 21 | Salmonella Enterica | GIVEQCCTSICSLYQLENYCN |
Insulin B chain | B | 30 | Salmonella Enterica | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Insulin B chain | D | 30 | Salmonella Enterica | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-06-13 Deposition Author(s): Matkovic-Calogovic, D. , Prugovecki, B. , Pulic, I. , Toth, M.