Crystal structure of certhrax catalytic domain
PDB DOI: 10.2210/pdb4fk7/pdb
Classification: TRANSFERASE/TRANSFERASE INHIBITOR Organism(s): Bacillus Cereus
Deposited: 2012-06-12 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dimov, S. , Edwards, A.M. , Hong, B.S. , Park, H. , Structural Genomics Consortium (Sgc) , Tempel, W.
Crystal structure of certhrax catalytic domain
Arrowsmith, C.H. , Bountra, C. , Dimov, S. , Edwards, A.M. , Hong, B.S. , Park, H. , Structural Genomics Consortium (Sgc) , Tempel, W.
Primary Citation of Related Structures: 4FK7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative ADP-ribosyltransferase Certhrax | A | 229 | Bacillus Cereus | GNVLDFKWYTRKAESWGVQTFKNWKENLTISEKDIITGYTGSKYDPINEYLRKYDGEIIPNIGGDLDKKSKKALEKIENQIKNLDAALQKSKITENLIVYRRVSELQFGKKYEDYNLRQNGIINEEKVMELESNFKGQTFIQHNYMSTSLVQDPHQSYSNDRYPILLEITIPEGVHGAYIADMSEYPGQYEMLINRGYTFKYDKFSIVKPTREEDKGKEYLKVNLSIYL |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-06-12 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dimov, S. , Edwards, A.M. , Hong, B.S. , Park, H. , Structural Genomics Consortium (Sgc) , Tempel, W.