Crystal structure analysis of the human insulin
PDB DOI: 10.2210/pdb4fg3/pdb
Classification: HORMONE Organism(s): Salmonella Enterica
Deposited: 2012-06-02 Deposition Author(s): Favero-Retto, M.P. , Lima, L.M.T.R.
Crystal structure analysis of the human insulin
Favero-Retto, M.P. , Lima, L.M.T.R.
Primary Citation of Related Structures: 4FG3
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin | A | 21 | Salmonella Enterica | GIVEQCCTSICSLYQLENYCN |
Insulin | C | 21 | Salmonella Enterica | GIVEQCCTSICSLYQLENYCN |
Insulin | B | 30 | Salmonella Enterica | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Insulin | D | 30 | Salmonella Enterica | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-06-02 Deposition Author(s): Favero-Retto, M.P. , Lima, L.M.T.R.