Crystal structure of deltarhodopsin from haloterrigena thermotolerans
PDB DOI: 10.2210/pdb4fbz/pdb
Classification: MEMBRANE PROTEIN Organism(s): Haloterrigena Thermotolerans
Deposited: 2012-05-23 Deposition Author(s): Kouyama, T.
Crystal structure of deltarhodopsin from haloterrigena thermotolerans
Primary Citation of Related Structures: 4FBZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| deltarhodopsin | A | 241 | Haloterrigena Thermotolerans | MAATVGPESIWLWIGTIGMTLGTLYFVGRGRGVRDRKMQEFYIITTFITTIAAAMYFAMATGFGVTEVVVGDEALTIYWARYADWLFTTPLLLLDLGLLAGANRNTIATLIGLDVFMIGTGMIAAFAATPGTRIAWWGISTGALLALLYVLVGTLSKDARGQSPEVASLFGRLRNLVIVLWLLYPVVWILGTEGTFGILPLYWETAAFMVLDLSAKVGFGVVLLRSRSVLRRVVTPTAAPT |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-05-23 Deposition Author(s): Kouyama, T.