Kinetic and structural characterization of the 4-oxalocrotonate tautomerase isozymes from methylibium petroleiphilum
PDB DOI: 10.2210/pdb4faz/pdb
Classification: ISOMERASE Organism(s): Methylibium Petroleiphilum
Deposited: 2012-05-22 Deposition Author(s): Hoffman, D.W. , Terrell, C.R. , Whitman, C.P.
Kinetic and structural characterization of the 4-oxalocrotonate tautomerase isozymes from methylibium petroleiphilum
Hoffman, D.W. , Terrell, C.R. , Whitman, C.P.
Primary Citation of Related Structures: 4FAZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 4-oxalocrotonate isomerase protein | A | 62 | Methylibium Petroleiphilum | PFAQIYLIEGRTEEQKRAVIEKVTQAMMEAVGAPKENVRVWIHDVPKENWGIGGVSAKALGR |
| 4-oxalocrotonate isomerase protein | B | 62 | Methylibium Petroleiphilum | PFAQIYLIEGRTEEQKRAVIEKVTQAMMEAVGAPKENVRVWIHDVPKENWGIGGVSAKALGR |
| 4-oxalocrotonate isomerase protein | C | 62 | Methylibium Petroleiphilum | PFAQIYLIEGRTEEQKRAVIEKVTQAMMEAVGAPKENVRVWIHDVPKENWGIGGVSAKALGR |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-05-22 Deposition Author(s): Hoffman, D.W. , Terrell, C.R. , Whitman, C.P.