Substrate ca/p2 in complex with a human immunodeficiency virus type 1 protease variant
PDB DOI: 10.2210/pdb4faf/pdb
Classification: VIRAL PROTEIN Organism(s): Human Immunodeficiency Virus 1 , Synthetic Construct
Deposited: 2012-05-22 Deposition Author(s): Brunzelle, J.S. , Dewdney, T.G. , Kovari, I.A. , Kovari, L.C. , Liu, Z. , Reiter, S.J. , Wang, Y.
Substrate ca/p2 in complex with a human immunodeficiency virus type 1 protease variant
Brunzelle, J.S. , Dewdney, T.G. , Kovari, I.A. , Kovari, L.C. , Liu, Z. , Reiter, S.J. , Wang, Y.
Primary Citation of Related Structures: 4FAF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HIV-1 protease | A | 99 | Human Immunodeficiency Virus 1 , Synthetic Construct | PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPTPTNVIGRNLMTQIGCTLNF |
| HIV-1 protease | B | 99 | Human Immunodeficiency Virus 1 , Synthetic Construct | PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPTPTNVIGRNLMTQIGCTLNF |
| substrate CA/p2 peptide | D | 7 | Human Immunodeficiency Virus 1 , Synthetic Construct | RVLFEAM |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-05-22 Deposition Author(s): Brunzelle, J.S. , Dewdney, T.G. , Kovari, I.A. , Kovari, L.C. , Liu, Z. , Reiter, S.J. , Wang, Y.