Advanced Search:
4FAF
Substrate ca/p2 in complex with a human immunodeficiency virus type 1 protease variant
PDB DOI: 10.2210/pdb4faf/pdb
Classification: VIRAL PROTEIN Organism(s): Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-05-22 Deposition Author(s): Brunzelle, J.S. , Dewdney, T.G. , Kovari, I.A. , Kovari, L.C. , Liu, Z. , Reiter, S.J. , Wang, Y.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.1 Å
Substrate ca/p2 in complex with a human immunodeficiency virus type 1 protease variant
Brunzelle, J.S. , Dewdney, T.G. , Kovari, I.A. , Kovari, L.C. , Liu, Z. , Reiter, S.J. , Wang, Y.
Primary Citation of Related Structures: 4FAF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HIV-1 protease | A | 99 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPTPTNVIGRNLMTQIGCTLNF |
| HIV-1 protease | B | 99 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPTPTNVIGRNLMTQIGCTLNF |
| substrate CA/p2 peptide | D | 7 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RVLFEAM |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2012-05-22 Deposition Author(s): Brunzelle, J.S. , Dewdney, T.G. , Kovari, I.A. , Kovari, L.C. , Liu, Z. , Reiter, S.J. , Wang, Y.