Crystal structure of active hiv-1 protease in complex with the n terminal product of the substrate ma-ca.
PDB DOI: 10.2210/pdb4f74/pdb
Classification: hydrolase/hydrolase product Organism(s): Hiv-1 M:B_Arv2/Sf2 , Synthetic Construct
Deposited: 2012-05-15 Deposition Author(s): Mittal, S. , Nalam, M.N.L. , Schiffer, C.A.
Method: X-RAY DIFFRACTION Resolution: 2.2 Å
Crystal structure of active hiv-1 protease in complex with the n terminal product of the substrate ma-ca.
Mittal, S. , Nalam, M.N.L. , Schiffer, C.A.
Primary Citation of Related Structures: 4F74
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 99 | Hiv-1 M:B_Arv2/Sf2 , Synthetic Construct | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
| Protease | B | 99 | Hiv-1 M:B_Arv2/Sf2 , Synthetic Construct | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
| N terminal product of substrate MA-CA | C | 5 | Hiv-1 M:B_Arv2/Sf2 , Synthetic Construct | VSQNY |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-05-15 Deposition Author(s): Mittal, S. , Nalam, M.N.L. , Schiffer, C.A.