Crystal structure of kaiso zinc finger dna binding domain in complex with kaiso binding site dna
PDB DOI: 10.2210/pdb4f6m/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-05-15 Deposition Author(s): Buck-Koehntop, B.A. , Dyson, H.J. , Ekiert, D.C. , Martinez-Yamout, M.A. , Stanfield, R.L. , Wilson, I.A. , Wright, P.E.
Crystal structure of kaiso zinc finger dna binding domain in complex with kaiso binding site dna
Buck-Koehntop, B.A. , Dyson, H.J. , Ekiert, D.C. , Martinez-Yamout, M.A. , Stanfield, R.L. , Wilson, I.A. , Wright, P.E.
Primary Citation of Related Structures: 4F6M
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcriptional regulator Kaiso | A | 133 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ANKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRS |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-05-15 Deposition Author(s): Buck-Koehntop, B.A. , Dyson, H.J. , Ekiert, D.C. , Martinez-Yamout, M.A. , Stanfield, R.L. , Wilson, I.A. , Wright, P.E.