Crystal structure of c-terminal domain of putative periplasmic protein ydgh from s. enterica
PDB DOI: 10.2210/pdb4evu/pdb
Classification: Structural Genomics, Unknown Function Organism(s): Salmonella Enterica Subsp. Enterica Serovar Typhimurium
Deposited: 2012-04-26 Deposition Author(s): Adkins, J.N. , Brown, R.N. , Cort, J.R. , Cui, H. , Heffron, F. , Joachimiak, A. , Michalska, K. , Midwest Center For Structural Genomics (Mcsg) , Nakayasu, E.S. , Program For The Characterization Of Secreted Effector Proteins (Pcsep) , Savchenko, A. , Xu, X.
Method: X-RAY DIFFRACTION Resolution: 1.45 Å
Crystal structure of c-terminal domain of putative periplasmic protein ydgh from s. enterica
Adkins, J.N. , Brown, R.N. , Cort, J.R. , Cui, H. , Heffron, F. , Joachimiak, A. , Michalska, K. , Midwest Center For Structural Genomics (Mcsg) , Nakayasu, E.S. , Program For The Characterization Of Secreted Effector Proteins (Pcsep) , Savchenko, A. , Xu, X.
Primary Citation of Related Structures: 4EVU
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Putative periplasmic protein ydgH | A | 72 | Salmonella Enterica Subsp. Enterica Serovar Typhimurium | GDGTKVEELNKATAAMMVPFDSVKFTGNYGNMTEISYQVAKRAAKKGAKYYHITRQWQERGNNITISADLYK |
Putative periplasmic protein ydgH | B | 72 | Salmonella Enterica Subsp. Enterica Serovar Typhimurium | GDGTKVEELNKATAAMMVPFDSVKFTGNYGNMTEISYQVAKRAAKKGAKYYHITRQWQERGNNITISADLYK |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-04-26 Deposition Author(s): Adkins, J.N. , Brown, R.N. , Cort, J.R. , Cui, H. , Heffron, F. , Joachimiak, A. , Michalska, K. , Midwest Center For Structural Genomics (Mcsg) , Nakayasu, E.S. , Program For The Characterization Of Secreted Effector Proteins (Pcsep) , Savchenko, A. , Xu, X.