Crystal structure of inactive single chain wild-type hiv-1 protease in complex with the substrate rt-rh
PDB DOI: 10.2210/pdb4ep2/pdb
Classification: hydrolase/hydrolase substrate Organism(s): Hiv-1 M:B_Arv2/Sf2 , Synthetic Construct
Deposited: 2012-04-16 Deposition Author(s): Mittal, S. , Schiffer, C.A.
Crystal structure of inactive single chain wild-type hiv-1 protease in complex with the substrate rt-rh
Primary Citation of Related Structures: 4EP2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| protease, tethered dimer | A | 203 | Hiv-1 M:B_Arv2/Sf2 , Synthetic Construct | PQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEILGHKAIGTVLVGPTPVNIIGRNLLTQIGMTLNFGGSSGPQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEILGHKAIGTVLVGPTPVNIIGRNLLTQIGMTLNF |
| substrate RT-RH | B | 8 | Hiv-1 M:B_Arv2/Sf2 , Synthetic Construct | AETFYVDG |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-04-16 Deposition Author(s): Mittal, S. , Schiffer, C.A.