Hiv protease (pr) dimer with acetate in exo site and peptide in active site
PDB DOI: 10.2210/pdb4e43/pdb
Classification: HYDROLASE Organism(s): Human Immunodeficiency Virus 1 , Unidentified
Deposited: 2012-03-11 Deposition Author(s): Stout, C.D.
Method: X-RAY DIFFRACTION Resolution: 1.54 Å
Hiv protease (pr) dimer with acetate in exo site and peptide in active site
Primary Citation of Related Structures: 4E43
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 99 | Human Immunodeficiency Virus 1 , Unidentified | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
| Protease | B | 99 | Human Immunodeficiency Virus 1 , Unidentified | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
| Random peptide | C | 6 | Human Immunodeficiency Virus 1 , Unidentified | NLLQKK |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-03-11 Deposition Author(s): Stout, C.D.