4E35
Crystal structure of cftr associated ligand (cal) pdz domain bound to ical36-l (ansrwptsil) peptide
PDB DOI: 10.2210/pdb4e35/pdb
Classification: PROTEIN TRANSPORT/PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-03-09 Deposition Author(s): Amacher, J.F. , Madden, D.R.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.4 Å
Crystal structure of cftr associated ligand (cal) pdz domain bound to ical36-l (ansrwptsil) peptide
Primary Citation of Related Structures: 4E35
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Golgi-associated PDZ and coiled-coil motif-containing protein | A | 87 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| Golgi-associated PDZ and coiled-coil motif-containing protein | B | 87 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| iCAL50 peptide | C | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ANSRWPTSIL |
| iCAL50 peptide | D | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ANSRWPTSIL |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2012-03-09 Deposition Author(s): Amacher, J.F. , Madden, D.R.