Crystal structure of cftr associated ligand (cal) pdz domain bound to ical36 (ansrwptsii) peptide
PDB DOI: 10.2210/pdb4e34/pdb
Classification: PROTEIN TRANSPORT/INHIBITOR Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2012-03-09 Deposition Author(s): Amacher, J.F. , Beck, T. , Madden, D.R.
Crystal structure of cftr associated ligand (cal) pdz domain bound to ical36 (ansrwptsii) peptide
Amacher, J.F. , Beck, T. , Madden, D.R.
Primary Citation of Related Structures: 4E34
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Golgi-associated PDZ and coiled-coil motif-containing protein | A | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| Golgi-associated PDZ and coiled-coil motif-containing protein | B | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| decameric peptide, iCAL36 | C | 10 | Homo Sapiens , Synthetic Construct | ANSRWPTSII |
| decameric peptide, iCAL36 | D | 10 | Homo Sapiens , Synthetic Construct | ANSRWPTSII |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-03-09 Deposition Author(s): Amacher, J.F. , Beck, T. , Madden, D.R.