Crystal structure of a plig-ec mutant, a periplasmic lysozyme inhibitor of g-type lysozyme from escherichia coli
PDB DOI: 10.2210/pdb4dxz/pdb
Classification: HYDROLASE INHIBITOR Organism(s): Escherichia Coli
Deposited: 2012-02-28 Deposition Author(s): Leysen, S. , Michiels, C.W. , Strelkov, S.V. , Van Asten, K. , Vanderkelen, L. , Vanheuverzwijn, S.
Crystal structure of a plig-ec mutant, a periplasmic lysozyme inhibitor of g-type lysozyme from escherichia coli
Leysen, S. , Michiels, C.W. , Strelkov, S.V. , Van Asten, K. , Vanderkelen, L. , Vanheuverzwijn, S.
Primary Citation of Related Structures: 4DXZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Inhibitor of g-type lysozyme | A | 111 | Escherichia Coli | AGKNVNVEFRKGHSSAQYSGEIKGYDYDTYTFYAKKGQKVHVSISNEGADTYMFGPGIDDSVDLSRYSPELDSHGQYSLPASGKYELRVMQTRNDARKNKTKKYNVDIQIK |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-02-28 Deposition Author(s): Leysen, S. , Michiels, C.W. , Strelkov, S.V. , Van Asten, K. , Vanderkelen, L. , Vanheuverzwijn, S.