4DS1
The structure of a yeast dyn2-nup159 complex and the molecular basis for the dynein light chain - nuclear pore interaction
PDB DOI: 10.2210/pdb4ds1/pdb
Classification: STRUCTURAL PROTEIN/TRANSPORT PROTEIN Organism(s): Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-02-17 Deposition Author(s): Romes, E.M. , Slep, K.C.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.851 Å
The structure of a yeast dyn2-nup159 complex and the molecular basis for the dynein light chain - nuclear pore interaction
Primary Citation of Related Structures: 4DS1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Dynein light chain 1, cytoplasmic | A | 97 | Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSMSDENKSTPIVKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNTWHVIVGKNFGSYVTHEKGHFVYFYIGPLAFLVFKTA |
| Dynein light chain 1, cytoplasmic | C | 97 | Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSMSDENKSTPIVKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNTWHVIVGKNFGSYVTHEKGHFVYFYIGPLAFLVFKTA |
| Nucleoporin NUP159 | B | 11 | Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | NYAESGIQTDL |
| Nucleoporin NUP159 | D | 11 | Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | NYAESGIQTDL |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2012-02-17 Deposition Author(s): Romes, E.M. , Slep, K.C.