Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with (1r)-3-(3,4-dimethoxyphenyl)-1-phenylpropyl (2s)-1-{[(1r,2s)-2-ethyl-1-hydroxycyclohexyl](oxo)acetyl}piperidine-2-carboxylate
PDB DOI: 10.2210/pdb4dro/pdb
Classification: ISOMERASE Organism(s): Homo Sapiens
Deposited: 2012-02-17 Deposition Author(s): Bracher, A. , Gaali, S. , Gopalakrishnan, R. , Hausch, F. , Hoogeland, B. , Kozany, C. , Kress, C.
Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with (1r)-3-(3,4-dimethoxyphenyl)-1-phenylpropyl (2s)-1-{[(1r,2s)-2-ethyl-1-hydroxycyclohexyl](oxo)acetyl}piperidine-2-carboxylate
Bracher, A. , Gaali, S. , Gopalakrishnan, R. , Hausch, F. , Hoogeland, B. , Kozany, C. , Kress, C.
Primary Citation of Related Structures: 4DRO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidyl-prolyl cis-trans isomerase FKBP5 | A | 128 | Homo Sapiens | GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-02-17 Deposition Author(s): Bracher, A. , Gaali, S. , Gopalakrishnan, R. , Hausch, F. , Hoogeland, B. , Kozany, C. , Kress, C.