Crystal structure of a triple-mutant of streptavidin in complex with desthiobiotin
PDB DOI: 10.2210/pdb4dne/pdb
Classification: BIOTIN-BINDING PROTEIN Organism(s): Streptomyces Avidinii
Deposited: 2012-02-08 Deposition Author(s): Deniaud, A. , Panwar, P. , Pebay-Peyroula, E.
Crystal structure of a triple-mutant of streptavidin in complex with desthiobiotin
Deniaud, A. , Panwar, P. , Pebay-Peyroula, E.
Primary Citation of Related Structures: 4DNE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Streptavidin | A | 183 | Streptomyces Avidinii | MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYVTARGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
| Streptavidin | B | 183 | Streptomyces Avidinii | MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYVTARGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-02-08 Deposition Author(s): Deniaud, A. , Panwar, P. , Pebay-Peyroula, E.