Small-molecule inhibitors of 14-3-3 protein-protein interactions from virtual screening
PDB DOI: 10.2210/pdb4dho/pdb
Classification: PROTEIN BINDING/INHIBITOR Organism(s): Homo Sapiens
Deposited: 2012-01-30 Deposition Author(s): Kohlbacher, O. , Ottmann, C. , Roeglin, L. , Thiel, P.
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Small-molecule inhibitors of 14-3-3 protein-protein interactions from virtual screening
Kohlbacher, O. , Ottmann, C. , Roeglin, L. , Thiel, P.
Primary Citation of Related Structures: 4DHO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 14-3-3 protein sigma | A | 235 | Homo Sapiens | AMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-01-30 Deposition Author(s): Kohlbacher, O. , Ottmann, C. , Roeglin, L. , Thiel, P.