Structure of 14-3-3 sigma in complex with padi6 14-3-3 binding motif i
PDB DOI: 10.2210/pdb4dau/pdb
Classification: SIGNALING PROTEIN/PROTEIN BINDING Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2012-01-13 Deposition Author(s): Ottmann, C. , Rose, M. , Rose, R.
Structure of 14-3-3 sigma in complex with padi6 14-3-3 binding motif i
Ottmann, C. , Rose, M. , Rose, R.
Primary Citation of Related Structures: 4DAU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 14-3-3 protein sigma | A | 234 | Homo Sapiens , Synthetic Construct | MGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT |
| Peptidylarginine Deiminase type VI | B | 13 | Homo Sapiens , Synthetic Construct | MVSVEGRAMSFQS |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-01-13 Deposition Author(s): Ottmann, C. , Rose, M. , Rose, R.