Crystal structure of cofactor-free urate oxidase in complex with the 5-peroxo derivative of 9-metyl uric acid (x-ray dose, 2.5 kgy)
PDB DOI: 10.2210/pdb4cw2/pdb
Classification: OXIDOREDUCTASE Organism(s): Aspergillus Flavus
Deposited: 2014-04-01 Deposition Author(s): Bui, S. , Steiner, R.A.
Crystal structure of cofactor-free urate oxidase in complex with the 5-peroxo derivative of 9-metyl uric acid (x-ray dose, 2.5 kgy)
Primary Citation of Related Structures: 4CW2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| URICASE | A | 301 | Aspergillus Flavus | SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKADNSVIVATDSIKNTIYITAKQNPVTPPELFGSILGTHFIEKYNHIHAAHVNIVCHRWTRMDIDGKPHPHSFIRDSEEKRNVQVDVVEGKGIDIKSSLSGLTVLKSTNSQFWGFLRDEYTTLKETWDRILSTDVDATWQWKNFSGLQEVRSHVPKFDATWATAREVTLKTFAEDNSASVQATMYKMAEQILARQQLIETVEYSLPNKHYFEIDLSWHKGLQNTGKNAEVFAPQSDPNGLIKCTVGRSSLKSKL |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-04-01 Deposition Author(s): Bui, S. , Steiner, R.A.