Crystal structure of fimh in complex with 3'-chloro-4'-(alpha-d-mannopyranosyloxy)-biphenyl-4-carbonitrile
PDB DOI: 10.2210/pdb4cst/pdb
Classification: SUGAR BINDING PROTEIN Organism(s): Escherichia Coli K-12
Deposited: 2014-03-10 Deposition Author(s): Abgottspon, D. , Eris, D. , Ernst, B. , Hutter, A. , Jakob, R.P. , Jian, X. , Kleeb, S. , Luedin, N. , Maier, T. , Mayer, K. , Navarra, G. , Pang, L. , Preston, R.C. , Rabbani, S. , Scharenberg, M. , Schwardt, O. , Sharpe, T. , Sigl, A. , Smiesko, M. , Zihlmann, P.
Crystal structure of fimh in complex with 3'-chloro-4'-(alpha-d-mannopyranosyloxy)-biphenyl-4-carbonitrile
Abgottspon, D. , Eris, D. , Ernst, B. , Hutter, A. , Jakob, R.P. , Jian, X. , Kleeb, S. , Luedin, N. , Maier, T. , Mayer, K. , Navarra, G. , Pang, L. , Preston, R.C. , Rabbani, S. , Scharenberg, M. , Schwardt, O. , Sharpe, T. , Sigl, A. , Smiesko, M. , Zihlmann, P.
Primary Citation of Related Structures: 4CST
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTEIN FIMH | A | 163 | Escherichia Coli K-12 | FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGLVPR |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-03-10 Deposition Author(s): Abgottspon, D. , Eris, D. , Ernst, B. , Hutter, A. , Jakob, R.P. , Jian, X. , Kleeb, S. , Luedin, N. , Maier, T. , Mayer, K. , Navarra, G. , Pang, L. , Preston, R.C. , Rabbani, S. , Scharenberg, M. , Schwardt, O. , Sharpe, T. , Sigl, A. , Smiesko, M. , Zihlmann, P.