Crystal structure of mhv-68 latency-associated nuclear antigen (lana) c-terminal dna binding domain
PDB DOI: 10.2210/pdb4blg/pdb
Classification: VIRAL PROTEIN Organism(s): Murid Herpesvirus 4
Deposited: 2013-05-02 Deposition Author(s): Beauchemin, C. , Carrondo, M.A. , Cerqueira, S.A. , Correia, B. , Kaye, K.M. , Li, S. , Mcvey, C.E. , Pires De Miranda, M. , Ponnusamy, R. , Rodrigues, L. , Schneider, T.R. , Simas, J.P.
Crystal structure of mhv-68 latency-associated nuclear antigen (lana) c-terminal dna binding domain
Beauchemin, C. , Carrondo, M.A. , Cerqueira, S.A. , Correia, B. , Kaye, K.M. , Li, S. , Mcvey, C.E. , Pires De Miranda, M. , Ponnusamy, R. , Rodrigues, L. , Schneider, T.R. , Simas, J.P.
Primary Citation of Related Structures: 4BLG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| LATENCY-ASSOCIATED NUCLEAR ANTIGEN | A | 141 | Murid Herpesvirus 4 | GPGYQKDPPKKYQGMRRHLQVTAPRLFDPEGHPPTHFKSAVMFSSTHPYTLNKLHKCIQSKHVLSTPVSCLPLVPGTTQQCVTYYLLSFVEDKKQAKKLKRVVLAYCEKYHSSVEGTIVKAKPYFPLPEPPTEPPTDPEQP |
| LATENCY-ASSOCIATED NUCLEAR ANTIGEN | B | 141 | Murid Herpesvirus 4 | GPGYQKDPPKKYQGMRRHLQVTAPRLFDPEGHPPTHFKSAVMFSSTHPYTLNKLHKCIQSKHVLSTPVSCLPLVPGTTQQCVTYYLLSFVEDKKQAKKLKRVVLAYCEKYHSSVEGTIVKAKPYFPLPEPPTEPPTDPEQP |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-05-02 Deposition Author(s): Beauchemin, C. , Carrondo, M.A. , Cerqueira, S.A. , Correia, B. , Kaye, K.M. , Li, S. , Mcvey, C.E. , Pires De Miranda, M. , Ponnusamy, R. , Rodrigues, L. , Schneider, T.R. , Simas, J.P.