Crystal structure of the bar domain of human amphiphysin, isoform 1 at 1.8 angstrom resolution featuring increased order at the n- terminus.
PDB DOI: 10.2210/pdb4atm/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Homo Sapiens
Deposited: 2012-05-08 Deposition Author(s): Allerston, C.K. , Arrowsmith, C.H. , Bountra, C. , Edwards, A. , Gileadi, O. , Krojer, T. , Von Delft, F. , Weigelt, J.
Crystal structure of the bar domain of human amphiphysin, isoform 1 at 1.8 angstrom resolution featuring increased order at the n- terminus.
Allerston, C.K. , Arrowsmith, C.H. , Bountra, C. , Edwards, A. , Gileadi, O. , Krojer, T. , Von Delft, F. , Weigelt, J.
Primary Citation of Related Structures: 4ATM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| AMPHIPHYSIN | A | 243 | Homo Sapiens | SMADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQRELRGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDESLLTLDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVFEEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHADKA |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-05-08 Deposition Author(s): Allerston, C.K. , Arrowsmith, C.H. , Bountra, C. , Edwards, A. , Gileadi, O. , Krojer, T. , Von Delft, F. , Weigelt, J.