4AR3
Near-atomic resolution neutron crystallography on the oxidised form perdeuterated pyrococcus furiosus rubredoxin.
PDB DOI: 10.2210/pdb4ar3/pdb
Classification: ELECTRON TRANSPORT Organism(s): Pyrococcus Furiosus (Strain Atcc 43587 / Dsm 3638 / Jcm 8422 / Vc1)
Deposited: 2012-04-20 Deposition Author(s): Blakeley, M.P. , Cuypers, M.G. , Forsyth, V.T. , Haertlein, M. , Mason, S.A. , Mitchell, E.P.
Experimental Data Snapshot
Method: NEUTRON DIFFRACTION Resolution: 1.05 Å
Near-atomic resolution neutron crystallography on the oxidised form perdeuterated pyrococcus furiosus rubredoxin.
Blakeley, M.P. , Cuypers, M.G. , Forsyth, V.T. , Haertlein, M. , Mason, S.A. , Mitchell, E.P.
Primary Citation of Related Structures: 4AR3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Rubredoxin | A | 54 | Pyrococcus Furiosus (Strain Atcc 43587 / Dsm 3638 / Jcm 8422 / Vc1) | MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED |
Experimental Data
Method: NEUTRON DIFFRACTION
Deposited Date: 2012-04-20 Deposition Author(s): Blakeley, M.P. , Cuypers, M.G. , Forsyth, V.T. , Haertlein, M. , Mason, S.A. , Mitchell, E.P.