3ZYH
Crystal structure of pa-il lectin complexed with galbg0 at 1.5 a resolution
PDB DOI: 10.2210/pdb3zyh/pdb
Classification: SUGAR BINDING PROTEIN/INHIBITOR Organism(s): Pseudomonas Aeruginosa (Strain Atcc 15692 / Dsm 22644 / Cip 104116 / Jcm 14847 / Lmg 12228 / 1C / Prs 101 / Pao1)
Deposited: 2011-08-23 Deposition Author(s): Bergmann, M. , Cacciarini, M. , Camara, M. , Darbre, T. , Garg, D. , Hurley, M. , Kadam, R.U. , Nativi, C. , Reymond, J.-L. , Sattler, M. , Smyth, A.R. , Stocker, A. , Swiderska, M.A. , Williams, P.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.501 Å
Crystal structure of pa-il lectin complexed with galbg0 at 1.5 a resolution
Bergmann, M. , Cacciarini, M. , Camara, M. , Darbre, T. , Garg, D. , Hurley, M. , Kadam, R.U. , Nativi, C. , Reymond, J.-L. , Sattler, M. , Smyth, A.R. , Stocker, A. , Swiderska, M.A. , Williams, P.
Primary Citation of Related Structures: 3ZYH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PA-I galactophilic lectin | A | 122 | Pseudomonas Aeruginosa (Strain Atcc 15692 / Dsm 22644 / Cip 104116 / Jcm 14847 / Lmg 12228 / 1C / Prs 101 / Pao1) | MAWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS |
| PA-I galactophilic lectin | B | 122 | Pseudomonas Aeruginosa (Strain Atcc 15692 / Dsm 22644 / Cip 104116 / Jcm 14847 / Lmg 12228 / 1C / Prs 101 / Pao1) | MAWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2011-08-23 Deposition Author(s): Bergmann, M. , Cacciarini, M. , Camara, M. , Darbre, T. , Garg, D. , Hurley, M. , Kadam, R.U. , Nativi, C. , Reymond, J.-L. , Sattler, M. , Smyth, A.R. , Stocker, A. , Swiderska, M.A. , Williams, P.