Design and synthesis of p1-p3 macrocyclic tertiary alcohol comprising hiv-1 protease inhibitors
PDB DOI: 10.2210/pdb3zpt/pdb
Classification: HYDROLASE Organism(s): Human Immunodeficiency Virus 1
Deposited: 2013-03-01 Deposition Author(s): Hallberg, A. , Joshi, A. , Larhed, M. , Rosenquist, A. , Samuelsson, B. , Unge, J. , Veron, J.B. , Wallberg, H.
Design and synthesis of p1-p3 macrocyclic tertiary alcohol comprising hiv-1 protease inhibitors
Hallberg, A. , Joshi, A. , Larhed, M. , Rosenquist, A. , Samuelsson, B. , Unge, J. , Veron, J.B. , Wallberg, H.
Primary Citation of Related Structures: 3ZPT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTEASE | A | 99 | Human Immunodeficiency Virus 1 | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNF |
| PROTEASE | B | 99 | Human Immunodeficiency Virus 1 | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-03-01 Deposition Author(s): Hallberg, A. , Joshi, A. , Larhed, M. , Rosenquist, A. , Samuelsson, B. , Unge, J. , Veron, J.B. , Wallberg, H.