N-terminal domain of the ci repressor from bacteriophage tp901-1 in complex with the ol2 operator half-site
PDB DOI: 10.2210/pdb3zhm/pdb
Classification: TRANSCRIPTION Organism(s): Fusarium Tricinctum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-12-22 Deposition Author(s): Frandsen, K.H. , Lo Leggio, L. , Poulsen, J.N. , Rasmussen, K.K.
N-terminal domain of the ci repressor from bacteriophage tp901-1 in complex with the ol2 operator half-site
Frandsen, K.H. , Lo Leggio, L. , Poulsen, J.N. , Rasmussen, K.K.
Primary Citation of Related Structures: 3ZHM
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
CI | A | 79 | Fusarium Tricinctum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KTDTSNRLKQIMAERNLKQVDILNLSIPFQKKFGIKLSKSTLSQYVNSVQSPDQNRIYLLAKTLGVSEAWLMGRSHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-12-22 Deposition Author(s): Frandsen, K.H. , Lo Leggio, L. , Poulsen, J.N. , Rasmussen, K.K.